DPCstruct | MC8347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 65 ± 14 aa |
| Standard deviation of domain lengths | 14.19 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 53.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05610 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W7PKK3 | 27-78 | MSESQFEYWRHTQLIIDVVPGNGGMFSIERATGLRFLTRSRLFSDEESDQLV |
| A0A2P8AWG3 | 2-60 | LLASLAVEGVPEPVEFWMSTAQWNLWKHTRLTVDVVPGRGSGFSLEAPEGVRFLIRSHL |
| A0A850LMA5 | 1-67 | None |
| A0A1G9TR65 | 195-256 | None |
| F8XR39 | 1-52 | None |
| A0A3G2JNF6 | 63-110 | None |
| A0A1C5D977 | 29-90 | None |
| A0A1H7I091 | 49-130 | None |
| A0A0Q9CVS5 | 131-195 | None |
| A0A6J4KX76 | 1-49 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.