DPCstruct | MC8346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 117 ± 9 aa |
| Standard deviation of domain lengths | 9.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0Y6U5 | 9-127 | AAKRTGTVWDAVSATQSLYPGTVIPRSFELAVSNNRIWVHGNATEHLAEYATSMLNRGVSRNLVNLASQQQLRSLQAAVQSAIANGI… |
| A0A2P8ATH3 | 759-872 | TGTVWDAIRGTQPNYPGTELPKSFELSLDAAEVWVHPNATEHIAEYANGLIKSGHGPEQVKVAVQAQLSSLQAAVNEATKNGVPLNQ… |
| A0A1E2VA94 | 445-587 | None |
| A0A1Q9JDJ6 | 411-533 | None |
| A0A7X9X1H0 | 13-135 | None |
| A0A5B2XJ47 | 58-175 | None |
| A0A2A2CAZ9 | 49-164 | None |
| A0A841ZPM2 | 294-409 | None |
| A0A809NSR8 | 2-113 | None |
| A0A516SCL7 | 12-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.