DPCstruct | MC8345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 198 ± 21 aa |
| Standard deviation of domain lengths | 20.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P8AQE0 | 17-202 | PVLVAWLGVAWIELANLQNASLLLFLIPPFELAVWLVAITLTVRLAYNARAGRRAAAGAAALLLIIGGWFTNWGLFHPASYWVTHRW… |
| A0A7D6ZIG7 | 9-200 | SAAPLGALVLAAVALGVTLHRGWIATEFWILTLPLLLAVFVMLSGGFALVLWLAFRGGRRWPLVATAIFVLIGAGGPVLLFSNSKAN… |
| A0A2B8J5E1 | 1-194 | None |
| A0A413RLQ1 | 3-196 | None |
| A0A4R6JAP3 | 59-304 | None |
| A0A3N1GTU6 | 46-246 | None |
| A0A7R7DV74 | 8-210 | None |
| A0A433CKY3 | 10-167 | None |
| A0A7Y6IG99 | 11-196 | None |
| A0A840PN59 | 20-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.