DPCstruct | MC8343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 13.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12807 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7XAM7 | 1-115 | MQTKTSKRRKQAGKRKGRLNLLLADSNEWASLTPKSLWSQLKSELRAYYDWELKPDSIDGAIEAYGLQKISLLRSFCLKTGIQILLR… |
| A0A1B0D8T5 | 398-500 | GKQAGPSVGVDNLEWAQLTQKSLWQQIRRELKVYWDWDLACDNLDAVVEMYKLQKISLLRAFCVKVGLQILLREYNFDARHRATFHE… |
| A0A3P7ILY2 | 57-167 | None |
| A0A2H1BTI3 | 2-97 | None |
| A0A1X7TLM3 | 73-200 | None |
| A0A1X7UCG6 | 9-136 | None |
| A0A1X7SKE7 | 1-128 | None |
| A0A813AUX2 | 3-121 | None |
| A0A817ED92 | 95-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.