DPCstruct | MC834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 88 ± 20 aa |
| Standard deviation of domain lengths | 20.18 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 83.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.35 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0005- PF03891 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A396U5G0 | 5-88 | IALVLVLLATSSCAQNKGTVAKINQAVTNTNIGVCKDPRPQMCTMEYLPVCGLISNKAVKTYGNACGACSDIHVTQYVKGECEN |
| A0A0F9DC58 | 112-172 | KHFCPPESRNVDACIEIYQPVCGWSDPDKIKCIKFPCASTYSNSCFACMDENVLYYTREVC |
| A0A151E8Y2 | 198-269 | None |
| A0A2D6NY73 | 9-97 | None |
| A0A2D6IK21 | 115-184 | None |
| A0A2D9WQQ1 | 97-169 | None |
| A0A2H0CVP7 | 137-204 | None |
| A0A2D6G6B7 | 4-110 | None |
| A0A1D2R8A8 | 333-433 | None |
| A0A850BHW5 | 23-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.