DPCstruct | MC8338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 9.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05000 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S5B943 | 98-186 | LQPTPGNTLRQTFENSVNKILNDARDKTGSCAQKSLSKYNNFNIMVVAGSKGSRINISQVIACVGQQNVEGKRIPFGFRHRTLPHFI… |
| A0A2G3BM84 | 20-100 | ATLKLPMVLNKDRDDAGSSAKKILSERNNFKATVTAGSKGSSINVSQMTAWVGQQNIEGKHIPFGLIDRNLPHSTKDDYGT |
| A0A061GWN1 | 71-147 | None |
| A0A4V1SY40 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.