DPCstruct | MC8337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 119 ± 8 aa |
| Standard deviation of domain lengths | 7.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4W9M1 | 198-312 | DICDVVQAVHLLQSKDPQVVAVAKSTLQRDVQQHIRQPPSMELTQEYLNASTEGLFAPPFVSRSSMWTRLRLATRNLRKIMPMEWKC… |
| A0A2R7X5N0 | 4-127 | LNSLCGIPKADEESDFALVDTAFKLLTSKDERVSSLAQSSLRNTLKDRSIQGGDLINPAVFLSGGTDGLRNRGSLPSNEWTRARRAS… |
| A0A7D9EYY9 | 375-499 | None |
| A0A4Y2T9S6 | 67-192 | None |
| A0A2R7VWR5 | 20-142 | None |
| A0A4Y2P123 | 122-246 | None |
| A0A7E4UTX5 | 1-99 | None |
| A0A7D9JUA6 | 70-186 | None |
| A0A2J7QFW2 | 160-269 | None |
| A0A6S7JFZ7 | 100-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.