DPCstruct | MC8336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 543 ± 68 aa |
| Standard deviation of domain lengths | 67.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0005 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7X4X0 | 2-563 | ARSPDCHEMCRRWVQEPGKVTWAVLSSTCTTPVQQCLNNMSKPFFLASPQKYLHCCEEATTADCKETCRRNLKKRVYDIEIMSNLKE… |
| A0A6J2PEF5 | 251-715 | PGVLQIEAATPSSLGNSIVEEVIHPCNPNPCPSNHVCQVNRRGCLDDLHCQPYICVPGCKLGEASEFLVQQDSRIQVPTRSGPSGCH… |
| A0A498LF10 | 100-615 | None |
| A0A672JRZ8 | 45-588 | None |
| A0A812EVH7 | 2-485 | None |
| A0A0S7KGP4 | 89-675 | None |
| A0A164KUE8 | 84-679 | None |
| A0A6P5UG58 | 203-827 | None |
| A0A6P7FSX3 | 456-1027 | None |
| A0A7R9KCA8 | 5-457 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.