DPCstruct | MC8335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 73 ± 4 aa |
| Standard deviation of domain lengths | 4.25 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 33.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0209 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0T6B5Q6 | 124-198 | SFVELVQGQKIVQKWRYKQWPEGHYSTVTINIHEKNDHTEVQLIQTGVPKNEVDVTKQNWDRYYWDSMKATFGFG |
| A0A2R7X475 | 1-79 | MSLFSQDQNKKIVQKWRLKSWPVDHYSTVILEIDQQDDHTMVKISQTGIPKGEIEGMKENWTRYYWHNIKRTFAWGFFM |
| A0A261Y5P2 | 361-429 | None |
| A0A7J7KRP9 | 47-120 | None |
| A0A167DZ14 | 170-243 | None |
| A0A3Q3WXS8 | 46-114 | None |
| A0A3M1CW68 | 35-102 | None |
| A0A183S4A7 | 1-63 | None |
| A0A653DDC7 | 656-732 | None |
| A0A7X9DQ15 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.