DPCstruct | MC8334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 7.03 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D2A033 | 150-232 | IKVPADTECTCGCPEKKKCLSDQKFDPILCKCVCTNKEEEEKCLEKLNMNFKWKSKDCTCGCKREKNCTTGTVWKREECRCVK |
| A0A2R7X3I4 | 20-106 | DCNAFQVYRKDECKCVCTNIDEMNKCLEDNKLKSWDPADCTCQCRNVKECSTGYIYNKHTCSCEPEQRHRINGGYLSDSRGGYRGRQ |
| A0A834MSD9 | 135-232 | None |
| A0A6G0YHB4 | 333-420 | None |
| A0A1Y1NGC0 | 37-119 | None |
| B4I6X8 | 1-84 | None |
| C4WXM2 | 222-305 | None |
| E9H9T1 | 236-337 | None |
| A0A1I8PDP6 | 137-216 | None |
| A0A5N4ANR9 | 246-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.