DPCstruct | MC8333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 217 ± 28 aa |
| Standard deviation of domain lengths | 28.17 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 35.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3ARU0 | 3-187 | VYDGEEHGQFMDKLEGRIRNHDREIEKMCNFHYQGFVDSITELLKVRWTAKNCKSQVTDTNRKLQNEGKELVILMEDLKQCRLQQRN… |
| A0A2R7X315 | 13-233 | DLFIQEIEGTDDYWGPTFRAVYDGDEEQKFMEQLDTRIKQHDRDIEKMCNYHYQGFIDSIRELLQVRSQAQKLNAEIIELNKELQES… |
| A0A6I9X8X6 | 1-179 | None |
| A0A670ZJW3 | 29-176 | None |
| M7BUT8 | 68-300 | None |
| A0A6J0Y6J7 | 19-242 | None |
| A0A2G8L7E5 | 8-206 | None |
| A0A7R8HEB8 | 252-482 | None |
| A0A0N1NZI8 | 11-246 | None |
| A0A183WDK9 | 11-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.