DPCstruct | MC8331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 10.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 55.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08326 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7X0I8 | 1-107 | VLIAAHQPAYELRHNQMESIFLSAVDMYGHDFHPENLQKLIQSETSIFDILHDFFYHTNRAVCNAALEVYVRRVYISYDMTCLQHLE… |
| A0A822AH33 | 350-454 | LIEFQQPPYELRLNQMESIFLSALDMYGHKFCQENLQKLILSETSIFDVLHSFYFHPNIQVRQSALEVYVRRSYISYDLTSIQHGFL… |
| A0A821R3B0 | 97-201 | None |
| A0A817KYC5 | 65-169 | None |
| A0A512UM59 | 296-414 | None |
| A0A818C258 | 320-424 | None |
| A0A821D6G6 | 306-410 | None |
| A0A1D2NDT0 | 1-90 | None |
| A0A3P8JF99 | 3-92 | None |
| A0A2I0TMN1 | 95-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.