DPCstruct | MC833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 233 ± 32 aa |
| Standard deviation of domain lengths | 32.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F6SGE9 | 2-191 | FKDLGLFLLPKSNGQYYIIKGEGYVDVPLISTKPKIYNSKLDFQLDTSKIGNSEMQHLDFAYAASLIRTFMKDPTLVLTIRGRKFTP… |
| C0XNN2 | 33-276 | KIFSRKGILQQIATDGYAIITSLEQKEFSGQLEPRLLNKHDFSSNQPYIFVREKLGALPIERNRYLIGKFNLFHSFPDTESSPPKTI… |
| A0A497NMH6 | 36-272 | None |
| A0A839LW62 | 65-322 | None |
| A0A2V5V5G8 | 325-518 | None |
| E0URG1 | 43-285 | None |
| S9QEJ6 | 17-218 | None |
| A0A103LNT6 | 13-220 | None |
| A0A4Q6DPX7 | 110-390 | None |
| A0A382MLS8 | 14-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.