DPCstruct | MC8329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 187 ± 24 aa |
| Standard deviation of domain lengths | 23.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15993 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7WZI6 | 9-182 | SDGLRGSSRYHELLLTILDDFLAAGLISPLVVAYWRGTWSLMDYFVYPHDPCISSGVSLFLGIAGVLVFTLTQKLYQSSLNPNLHRL… |
| E9HRE5 | 9-227 | LTDTVLSLCLVAPMVVGYWRGTWFLLDAYLYPDDAAASCWISLLLGFGSLLLATWFQRQLQDYVTRQTPCIYFLLSRLYTVVLCFGC… |
| R7TQ57 | 5-193 | None |
| A0A5E4PT87 | 19-187 | None |
| A0A5E4PTC7 | 30-191 | None |
| A0A3Q0JIZ1 | 8-201 | None |
| A0A1B0BRP4 | 38-206 | None |
| A0A821US88 | 25-213 | None |
| A0A482VQF9 | 36-226 | None |
| T1FGX1 | 9-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.