DPCstruct | MC8327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 308 ± 43 aa |
| Standard deviation of domain lengths | 43.38 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 34.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7WYK4 | 9-331 | CFRFLQSLVMASTGLCMGTDYRIALLCNAYSTNQEYFSRPMAALIESILGSSKGSGGGPAGAGSAAPLASTTGPTTPLSMSILDSLT… |
| K1QGD4 | 147-497 | EFLKQSLNNKNLSLNDYKIALLCNAYSTNNDYFNLPMGKLVESIYGDSKHTTLLPGNIVASAPTQPLAMSLLDSLTVHAKMSLIHSI… |
| A0A817HLQ3 | 242-588 | None |
| A0A6S7I0L1 | 110-416 | None |
| A0A7R9AQT1 | 415-701 | None |
| A0A2G3CM05 | 150-425 | None |
| A0A151T8F0 | 70-374 | None |
| H2YVM4 | 353-707 | None |
| A0A287UNR9 | 300-658 | None |
| A0A0A9CNK6 | 3-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.