DPCstruct | MC8326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 139 ± 8 aa |
| Standard deviation of domain lengths | 8.44 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7WXX0 | 1-148 | MFGNGVGTLSVLLRDTRERQDREIWSLTGEAGNAWYQAEVSVSSSRTLKLHGRKAAPQIAAPGSGDCTFEVDECGWSNIVSRERLDD… |
| A0A7M7T4S5 | 3-140 | GADIGTLNIYAKTGTTLGQVLWTQSGALSRNWFQAQIDFIPTADFKFVFEGVTGADYESDIALDDIYITTGACGGSICGCDFDLDLC… |
| A0A2C9KD41 | 1-131 | None |
| A0A4W4DPY6 | 108-238 | None |
| A0A820RLJ7 | 33-177 | None |
| A0A3Q2CDT5 | 1-116 | None |
| A0A3B3YPG5 | 803-941 | None |
| U6JPA5 | 397-546 | None |
| A0A1S3JJ42 | 960-1107 | None |
| A0A6J8F307 | 189-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.