DPCstruct | MC8325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Standard deviation of domain lengths | 10.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 47.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7R0T7 | 1-72 | MEEIKQEDIHDLLEHFCRCLYKAAEADSKSRDVMQRCLKLVTLDYSHVVISNSEGELSANYPSHLIILEYEH |
| A0A2R7WXB2 | 6-100 | TEEIRSLLKYFSNKTFRARDADPEAQNVMKKCIDLVSLDYNHVLVDNSGGDLCAHYPSQLIFMEYEKVDKKDELQCELDTPLKSTDD… |
| A0A5E4DBS9 | 13-104 | None |
| A0A6F8ZWC8 | 4-96 | None |
| A0A6J0C9U2 | 1-89 | None |
| A0A2R2MQM4 | 5-85 | None |
| A0A0P7VTT5 | 176-288 | None |
| D6RFN8 | 15-105 | None |
| L9KQR5 | 18-111 | None |
| A0A6A4SQ62 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.