DPCstruct | MC8323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 249 ± 20 aa |
| Standard deviation of domain lengths | 19.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 51.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7WX25 | 1-265 | MFMRMACEVPVLESTIVSILATGISKDLPLSPGEAFEITEQVVKRAAAIINPIRPVLEVEKTKILDLVFNLSTYRHPDNIDLPQGYT… |
| A0A6J1W7P2 | 77-343 | ESDRNFFLRLCSEVPILEDTLMRILVIGLSRELPLGPADAMELADHLVKRAAAVQADDLEVLRVERIQLIDAVLNLCTYHHPENIQL… |
| A0A485NKH0 | 463-700 | None |
| A0A0R4IJ75 | 632-895 | None |
| A0A6I9N5I5 | 76-337 | None |
| A0A6P3RS16 | 1-213 | None |
| A0A183H151 | 255-517 | None |
| E9HPE2 | 7-219 | None |
| T1J830 | 621-882 | None |
| A0A3P4LTM5 | 472-732 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.