DPCstruct | MC8321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Standard deviation of domain lengths | 4.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 41.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2UMQ5 | 38-96 | MRRDMVDQLQGGVSMRVRQHFDDMKRATVREQDYFYHPLINTPFSLGIALPRDYGRQRV |
| A0A2R7WUY3 | 1-72 | MREVLVNGTEDSILGLKIKFHYDDMRRVGVETRNYFFAPLNNTPFTMGLALPHSYGNFWIKAGDEIMKSKQM |
| A0A2R7VSA1 | 1-66 | None |
| A0A482XLN1 | 102-172 | None |
| A0A1I8NVI1 | 33-103 | None |
| A0A1S4EPL1 | 1-68 | None |
| A0A067QSP7 | 55-123 | None |
| A0A7R8UST1 | 179-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.