DPCstruct | MC8320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 204 ± 22 aa |
| Standard deviation of domain lengths | 22.24 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7WTW7 | 12-188 | TLLKQEELRKYGLKENLEPKKARELLRYIYDQIHPGLPEQMVPSNPSTSKEVCGVSPLSSNSTSDREIHSDEEKQESNEYILEEKFF… |
| A0A316VP89 | 74-262 | DEGDQNAEARMANMSIDELREQINKYGLRLSKSRKVMIEQLQSVYRAIRQAKAVKDTQVGDTSSLFSSDRDESGEDNDDDEEEESDD… |
| A0A818D966 | 55-215 | None |
| A0A3P7KVQ4 | 348-536 | None |
| A0A4U5N601 | 75-271 | None |
| A0A6J2YPZ9 | 839-1041 | None |
| E2BQ49 | 990-1185 | None |
| A0A067RPP1 | 156-381 | None |
| S4RAE5 | 3-197 | None |
| A0A0N4Z2I7 | 626-822 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.