DPCstruct | MC8319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 7.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07327 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9HJZ5 | 1-58 | CVYGIVKDYCGRDICAKGPGHRCGGKWNSLGICGEGLFCSCNRCGGCSLNTIECFNLT |
| A0A2R7WTQ9 | 8-74 | ERCEVDLKSCTYGTVRLCGQVLCAKGPGMRCGGYMNIRGKCAEGLTCNNCGYCTGCFKDSLDCYKSD |
| A0A444SLR7 | 98-172 | None |
| E2BLJ9 | 83-148 | None |
| A0A6P3Y989 | 40-107 | None |
| A0A482VRF0 | 2-81 | None |
| A0A226DYS0 | 93-169 | None |
| A0A1E1G7T3 | 27-106 | None |
| A0A834IFU4 | 56-132 | None |
| A0A6J0BBG7 | 47-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.