DPCstruct | MC8318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 4.22 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 65.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00285 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7WTK8 | 3-63 | GGMRGIKALVCETSVLDPDEGIRFRGYSIPECQKLLPKAAGGKEPLPEGLFWLLVTGDIPT |
| A0A453NMZ5 | 1-62 | MRGMTGMLWETSLLDPEEGIRFRGLSIPECQKVLPAAVKDGEPLPEGLLWLLLTGKVPTKEQ |
| A0A139WHG4 | 453-517 | None |
| A0A654GRC5 | 74-139 | None |
| A0A2K6SCW8 | 49-112 | None |
| A0A2K6G686 | 70-135 | None |
| A0A287TVX3 | 77-140 | None |
| A0A7J7ZD58 | 44-121 | None |
| A0A2A9MIU4 | 147-207 | None |
| A0A2H9ZVR4 | 12-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.