DPCstruct | MC8317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 7.23 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1W1Y2 | 1-76 | MGHLDVVVPPDFIPEETSGDVMVPEGGTARVSCRARGTPPPRVMWKREDGQDIVVRDTAGFKNKVSLYEHEVLTLS |
| A0A2R7WS48 | 47-103 | SCSPVPVPPDIIYNQTSPDLSLNEGENATLECHATGHPTPRITWRREDGDLITLKQP |
| A0A833RXB9 | 1-57 | None |
| A0A7E4S5E0 | 3-57 | None |
| A0A6G0TUC3 | 153-216 | None |
| T1JP54 | 1-59 | None |
| A0A182VTM8 | 67-120 | None |
| A0A182VQR1 | 6-65 | None |
| A0A482VM68 | 1-58 | None |
| A0A2R7W9A5 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.