DPCstruct | MC8315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 102 ± 9 aa |
| Standard deviation of domain lengths | 8.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7WR19 | 14-109 | NLNTFHLCEAPGAFISALNHYIKLKHENIKWKWKACTLNPYYEGNSLEEMINDDRFIYKTLDNWWFGKDYTGNIRNSTNLRSVEELK… |
| A0A6C0EBA8 | 354-441 | QAFLKMCEILYNVELIDKNDINVFHVCEAPGQFILAFTRYCEKRNINYNWKATTLRNGLGDTYGLIKNNQDKWKFGKDDTGDITVIDN |
| A0A835NUL5 | 8-108 | None |
| A0A7J6UQ04 | 117-228 | None |
| A0A7J6UPB8 | 183-277 | None |
| A0A0M3HLM7 | 1-103 | None |
| A0A4C1TTH3 | 41-138 | None |
| A0A061D4B9 | 142-243 | None |
| A0A368FUS3 | 108-214 | None |
| T1KPW6 | 17-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.