DPCstruct | MC8313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 283 ± 51 aa |
| Standard deviation of domain lengths | 51.46 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.00 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | PF00346- PF06350 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402G1I1 | 1-170 | MDSRPLFQTLHSLVEDNATFFRDTTTETSQRFVAAFTTIREHAQYLEPLLSHFATIYHIFDLDEHTPANGYRSLAQTVHCCLAHIVH… |
| A0A2R7WQ12 | 1-270 | MMNGHLNDTDIAASFKFMKNLAVSNLEFFRNDKYDTGAKFVDQLNQLVEQADPLLELVDNVSEKASSYDFSEESRGNGHASWIKNTH… |
| A0A4C1VSY5 | 1-277 | None |
| A0A4Z2CZE2 | 2-336 | None |
| A0A3Q2UIJ0 | 1-301 | None |
| T1ER00 | 3-304 | None |
| A0A2B4S4S7 | 459-708 | None |
| A0A6V7W793 | 1-316 | None |
| A0A817MAQ1 | 2-188 | None |
| A0A183MME1 | 47-420 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.