DPCstruct | MC8312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 299 ± 16 aa |
| Standard deviation of domain lengths | 16.26 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A023FPG7 | 34-312 | AELKWVFEESGRSFLLSREWIPLQGPSEDAMTRRADSCSLLAAVSQLYRERVLHRAVAALAASGRPSRGGPDALHLVELLEGASEGG… |
| A0A2R7WPM7 | 3-272 | WILTPAGQNFTLSNQWSYSSNENIFTELTDNTCPMAFTCKVFRENLIEGLLESLIAPGTQVSIPGIDSSGRIESMMNLLLTNLTFKG… |
| A0A7J8JM79 | 226-532 | None |
| A0A834B251 | 68-374 | None |
| A0A158PKM1 | 213-511 | None |
| A0A3S3PDG2 | 673-968 | None |
| A0A1Y3AMY2 | 6-314 | None |
| A0A1L8DFD9 | 283-587 | None |
| A0A183J3W7 | 1-330 | None |
| A0A674MW07 | 524-809 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.