DPCstruct | MC831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 82 ± 12 aa |
| Standard deviation of domain lengths | 11.79 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A327KV64 | 9-79 | TVGLLLGGLGAATANAQGEYRGTPAQQRACRPDVFRLCAGEIPNVKAITACLAARVSRLSPDCRAVFEAAG |
| A0A401XGA0 | 1-89 | MTHFMRRISIMLSSVAMIGLAYPAHADALREKQTEACKGDALRLCALAIPNEKKITKCMERKQDQLSPKCRAFFKKGSKTPQAHKPK… |
| A0A431MDP4 | 8-102 | None |
| A0A7W9WV78 | 24-97 | None |
| A0A5H2Z279 | 20-90 | None |
| A0A0D7EH64 | 9-78 | None |
| B0UAF5 | 5-85 | None |
| D6V241 | 83-176 | None |
| A0A537L921 | 1-70 | None |
| A0A380W7B6 | 10-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.