DPCstruct | MC8309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 235 ± 36 aa |
| Standard deviation of domain lengths | 36.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09745 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1N541 | 14-226 | LKYGLNPAASKKKTAVRKKPILAAFAAGDDDDDDANATHRERANAEVLRQQAAAKRAQKARELHSAALAEDPSVFDYDGHFDGFQDA… |
| A0A2R7WN23 | 1-216 | MSSNKQYGLQIPKKISGGLVQKHSAFGEDTDSDRSDGGGTDWTKRALKATEKSTIKRQTKIEMQRAIDVDSTVYQYDEIYDQMQKGK… |
| A0A7G2EE86 | 195-503 | None |
| A0A7J7MI27 | 46-266 | None |
| A0A7I8VLL4 | 9-253 | None |
| A0A3F2RJ98 | 18-307 | None |
| M7Z6J3 | 1-303 | None |
| A0A5S6PZK9 | 2-226 | None |
| A0A0V1ETZ1 | 1-247 | None |
| A0A3L7HR10 | 3-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.