DPCstruct | MC8307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 181 ± 27 aa |
| Standard deviation of domain lengths | 26.74 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.10 |
| Pfam Score | 84.62 |
| Assigned Pfam label(s) | PF08996- CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9U2Y1 | 140-324 | SHRELENPALEFAKAVTHVLELDKHCADEVVVLRRLLLAELGMREFGKNATWEDPSMSYVLRDTICTFCNACVDLDICRDASLCTGP… |
| A0A2R7WN18 | 54-227 | SVCKVLSLDPTVEEEVGRLRRNLLRLLGVGEFSESSQWIDPCATIVLPEVICRACNHCRDIDLCKDPNRTVENEVHVWLCPICNTSY… |
| A0A813B1H1 | 77-249 | None |
| A0A368FLK5 | 303-483 | None |
| A0A1W0E5S0 | 67-210 | None |
| A0A1Q9DSG3 | 748-919 | None |
| A0A182TKN8 | 19-158 | None |
| A0A183J8H8 | 4-262 | None |
| A0A6S7KPU3 | 5-175 | None |
| A0A183WBK4 | 329-561 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.