DPCstruct | MC8306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 104 ± 14 aa |
| Standard deviation of domain lengths | 13.57 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 48.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M2WXK1 | 297-386 | YSWRTNLEESECYWKSWFENLSPTFLKIAVPKLLILAGQDRLDKPLTIAQMQGQFQLSVVRDSGHNLHEDQPEGTAQIFVEFLRRHS… |
| A0A2R7WMD0 | 3-109 | ASGKYGWRIDLRATENHWPGWFQGLSKLFLSCSAQKLLLLASLDRLDTDLTVAQMQGRFEVHAFEQSRGRCGHVIHEDIPDAVAEVL… |
| A0A7J8H4R8 | 38-143 | None |
| A0A0N1I719 | 5-115 | None |
| A0A164Y811 | 259-358 | None |
| A0A4T0IZP0 | 505-596 | None |
| A0A2A6CH84 | 605-703 | None |
| A0A556U026 | 127-229 | None |
| A0A183SQW0 | 234-357 | None |
| W6PSE6 | 901-998 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.