DPCstruct | MC8304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 165 ± 17 aa |
| Standard deviation of domain lengths | 16.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 58.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9I4U6 | 291-450 | LIWAVMLLSAAVAITLPKPSGIRTLIMTVILRLICSAGPQPTLMLLGTATVVLKGVHLLSIMGNAGTFQRSVRQICTDTEIVYHVVH… |
| A0A2R7WLV8 | 1-165 | MIWAVMLISAAIVITLPRESGIRTLVASTILRMIFSAGPEPTLWLLGTLTVFLKGIHLISIMGNQGTFSKKVKQIVEDAEILYHLAY… |
| T1GKS4 | 2-160 | None |
| A0A1I8HTI5 | 419-594 | None |
| A0A2I0TIT1 | 354-529 | None |
| A0A821ID49 | 57-201 | None |
| E9I1F6 | 64-218 | None |
| E9H576 | 2-136 | None |
| A0A444V486 | 135-321 | None |
| A0A6I9NU00 | 1-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.