DPCstruct | MC8303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 7.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01805 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077ZDB3 | 8-73 | DCPPSDLETRGIIDKLAEFVARNGPEFEVLTREKQRHNPKFSFLFGGLHSAYYKRKLEAARAGIVL |
| A0A2R7WJ84 | 5-71 | LPKAPQDIELRNIIDKLAQFVARNGPEFEQMTKNKQKGNPKFSFLFGGEYFNYYQYKVTTEQAILKV |
| A0A7R8ZAL3 | 67-151 | None |
| A0A182EIY3 | 12-96 | None |
| A0A7J8H248 | 44-104 | None |
| A0A2H1BSF0 | 1-74 | None |
| A0A0R3RBP0 | 12-95 | None |
| A0A7R8W6C6 | 261-330 | None |
| A0A1S3YFR2 | 46-124 | None |
| A0A2T7NNV8 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.