DPCstruct | MC8302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 199 ± 30 aa |
| Standard deviation of domain lengths | 30.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.32 |
| Pfam Score | 96.77 |
| Assigned Pfam label(s) | PF02734- PF11957- PF07818 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446UF03 | 11-182 | ESSCMITRLLDMMLYLCERGHVEAGMVFQLLEDLTDMSTIKDCKHVFGYIESKQDVLGKQELFRRGKLVMLRTCNQLLQRLSKSNDV… |
| A0A2R7WJ81 | 46-231 | LDELNKFLASGNIERLKQRWSSYHAKDVTKRVSLEQALKDKLVSLLSFAKKDSHIEDLIHFLESALVLCTNEQITVITFVSILSDIV… |
| A0A818DFK1 | 14-220 | None |
| G1Q608 | 1-217 | None |
| A0A1Y3BRK8 | 181-373 | None |
| A0A0P0VS60 | 3-182 | None |
| S4RFN5 | 25-172 | None |
| A0A177V7C2 | 41-301 | None |
| A0A0C2MDM0 | 2-155 | None |
| I1CHU3 | 21-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.