DPCstruct | MC8301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 106 ± 8 aa |
| Standard deviation of domain lengths | 8.35 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.81 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF05667- PF21674 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402G1Z6 | 1-99 | DIPDEVESIREFTTELIVEAVVRCLRVINPSVGAGLSHILPPGMSARFRIGMSLAQAFQDLGYQGEIGYQTFLYSSEPEIRRLLLFL… |
| A0A2R7WIS9 | 1-99 | MEEVDKIIIHSLKDIGCDINDEIDSLEGFTTDIVIDATVRCLEIIKPETNISRTLPQNMAARFHLGSAIAEACKNLGYSGEVGYQTF… |
| L8H7P0 | 1-100 | None |
| A0A2I0VKN5 | 1-114 | None |
| B4DLA4 | 2-118 | None |
| A0A5N6M017 | 1-97 | None |
| D3B059 | 358-475 | None |
| A0A1X7T484 | 10-122 | None |
| A0A5A8C378 | 6-116 | None |
| A0A2D4CJQ8 | 6-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.