DPCstruct | MC8300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 197 ± 21 aa |
| Standard deviation of domain lengths | 21.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2U0P1 | 1-214 | MHEHVKAEEMNSPWIEQVVAEKDCQPAAIETYLNRRFSEKRVAYDPSDPEANKLAVSKGYVVVTGSMMSSGAWKNSKAAQAILPAGQ… |
| A0A7X6R6P0 | 83-296 | DDLAAFTTGGMHDELGWNDIALHACRVLATHEKVVFVSRSDREFGAAQLDDARDEGFRLVLVPDNIAGRIGNLTDFEGEPLYDLDGY… |
| A0A1V5Z396 | 207-398 | None |
| A0A497SMY1 | 33-235 | None |
| A0A7C4CSP4 | 336-520 | None |
| A0A7S2RRB2 | 101-348 | None |
| A0A0F9QE84 | 241-445 | None |
| E4YQC0 | 425-603 | None |
| A0A1Q9MYK3 | 139-350 | None |
| A0A177B0I1 | 4-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.