DPCstruct | MC830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 142 ± 19 aa |
| Standard deviation of domain lengths | 19.46 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5Q4EVK9 | 37-189 | GLRLTPAGKDAADSVFWEQQTTLPPGLIDEVYASFEAVNTRCKTLVSQWQVREVDGETVPNDHSDAEYDQAIIDGIHAIYRAVKPAL… |
| A0A7X6L6F8 | 14-157 | RLTPEGRQHLDGLLATERRAVDRAAIASVYAEFCAFNGTLKEIVTAWQMKDPATVNDHADAEYDGAVLTRLTELHRGVQPLLRRIGD… |
| A0A6J6PUS8 | 18-154 | None |
| A0A7Y6CTR4 | 34-181 | None |
| A0A2A9F972 | 41-217 | None |
| A0A1G4PQ19 | 165-307 | None |
| A0A6J7HGD8 | 2-109 | None |
| A0A3S0D568 | 49-203 | None |
| A0A7W5Y960 | 18-139 | None |
| A0A235G5Q7 | 85-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.