DPCstruct | MC83
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Standard deviation of domain lengths | 4.95 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M2H8C4 | 30-85 | TARRRVIAKYRGDDGWQPVKGVRLDDESAQAFMADGVTLVRVRRRGREIEVGLRRY |
| A0A1R3X517 | 1-62 | MTRPRTLTHVYTLAGGWQKAPHEPLTPETAAALRDQGITLVRARRGFFDSREISLRQYPPTR |
| A0A5R8LDA1 | 1-58 | None |
| A0A147ESH1 | 9-70 | None |
| A0A542MYW3 | 41-95 | None |
| A0A1E4BNQ5 | 4-70 | None |
| A0A2T0V3B7 | 9-64 | None |
| A0A3D9T5G5 | 1-70 | None |
| A0A1R3X5W0 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.