DPCstruct | MC8299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 6.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X6L7X0 | 1-94 | MHSTTFGDHTVLWRIVRGSRIAIESLIDHAAGAPAYRMRMDGSIIDIPNGDPGMIYFGEGEDRPDLAQVREWFPKLFDLWNTVRTQY… |
| A0A1H8YQX3 | 94-180 | CTTLDGYQITWYREAPADREGGLVSIFDPESTEPARRLLPDGTAESLDGAPRGLTVYGRHRSDRPSFARASLMTPEYTYLINGVKED |
| A0A421B1V2 | 11-93 | None |
| A0A2A7UJ24 | 2-76 | None |
| A0A0C1CQN5 | 1-96 | None |
| A0A318K9I3 | 7-99 | None |
| A0A0M8WEZ3 | 237-323 | None |
| A0A1I5X8G2 | 134-217 | None |
| A0A511MN01 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.