DPCstruct | MC8296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 88 ± 4 aa |
| Standard deviation of domain lengths | 3.92 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9IZL8 | 2-89 | TSIHTIPLLFLNLGGEMMYILDQRLQAQKIPKDKSMKVMNDITSIMLNEKFLGELFKPQEVYNKQALRKLFEDLAHGSIMRLNSASMD |
| C1BZQ6 | 1-89 | MSSRTLPLLFIDLGGEMLYILDQRLRAQNIPADKAKKVMNDIITTMFNKKFLEELFKPQELYPKKALRTVFDRLAHASIMRLNQASM… |
| A0A7F8R2E2 | 1-99 | None |
| A0A3B5QHI1 | 1-93 | None |
| B7PHA9 | 1-89 | None |
| A0A672KBX4 | 1-85 | None |
| A0A4P9WC94 | 1-90 | None |
| A0A1Q9C594 | 196-279 | None |
| A0A0M3JC19 | 1-84 | None |
| G1TSV5 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.