DPCstruct | MC8294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 64 ± 10 aa |
| Standard deviation of domain lengths | 9.83 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 51.23 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | CL0123- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5GE61 | 5-66 | HFTPPPEAPVFRPGQDEFDDPISFIRKIRPEAEKFGICRIIPPENWRPPFSLDLNNFVFNPR |
| C1BWS2 | 1-59 | MTQPRPNEFIAPPECPVFEPSWEEFADPFAYINKIRPIAEKTGICKVRPPKVSFFNKGI |
| A0A061F1H1 | 6-91 | None |
| A0A8B6DN68 | 3-72 | None |
| A0A6V7YDI6 | 12-80 | None |
| A0A6J1X2E3 | 21-86 | None |
| A0A199VV12 | 37-106 | None |
| A0A7S2UMF3 | 53-122 | None |
| A0A6I8SML2 | 1-67 | None |
| A0A803J4M5 | 2-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.