DPCstruct | MC8292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 415 ± 53 aa |
| Standard deviation of domain lengths | 53.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2LGN1 | 1-371 | MASSNFSGTVTGGIQDISALLPLLGTEQCEKHVGSALDRGFLYSSVTPISIFGSLGIVRAAFNILIASLSIPQFQFLGAKKLNDGGF… |
| A0A4Y7TTC1 | 115-493 | VVGVATSGIQDVSALLPLLGTDQCERLVTSALQHGLLYAAAAPMSIFGSLGIVKAGFVVLWSCIDHRPFSGPKGVRNAGFVSSGIGE… |
| A0A369K1R9 | 9-501 | None |
| A0A0C3FA66 | 6-427 | None |
| A0A4Q2DXY1 | 1-350 | None |
| V2X0G8 | 11-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.