DPCstruct | MC8291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 188 ± 17 aa |
| Standard deviation of domain lengths | 17.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9XBM9 | 3-188 | LDWTDMAPEVLQKILIHATATSPIGLPKEWFNLVLSCRHFRDCLSCNSRKLFSTLFAQKFDISAPVRRLGEDVVQNSAKLEMQRRFN… |
| A0A0C3G202 | 5-181 | QQNSILCRFPAEILENIALEAVRFEFLGPPKALISLLCTCKSMHNALAFNQCYDLYTRIFETKFDIDAVRRRFGLKSVRLTNLAMQL… |
| A0A4Y7TIL1 | 1-170 | None |
| A0A0K6FZZ5 | 297-480 | None |
| A0A4Q2DPZ6 | 2-180 | None |
| A0A165QX57 | 8-171 | None |
| G4TDB4 | 136-321 | None |
| S7RN38 | 10-177 | None |
| A0A5B1QD97 | 2-204 | None |
| J4HVF5 | 2-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.