DPCstruct | MC8290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 308 ± 74 aa |
| Standard deviation of domain lengths | 74.28 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 66.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2LWQ6 | 13-380 | VKNAIFTVARFLNLDPEMEVFICLLGDDVLETLFGRVRMIGGHSPNCNIYELRYRMASAKNVDAIFRRHPEWEKQPRRLKLFRGRDT… |
| A0A0C3FLW0 | 13-279 | AKLDHISPRSWRGDVTVKNVVLLTCWSEGRRTASSQLLHAGWTAPFDEMEKIGGFDMFCPLGENRMVLMDGLTEGERNEDDEETDIR… |
| R7SFJ0 | 32-318 | None |
| A0A4S8M0B8 | 9-251 | None |
| A0A4S8LKC1 | 551-848 | None |
| A0A4V4HI01 | 54-363 | None |
| A0A0B7FPE5 | 279-575 | None |
| E2L6M8 | 2-221 | None |
| A0A4Z0A828 | 2-269 | None |
| V2WKC3 | 39-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.