DPCstruct | MC829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 267 ± 32 aa |
| Standard deviation of domain lengths | 32.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0QE08 | 124-398 | IRQRSTWFIPASFAFGILAIAAIVAVSVLSGAPLRGSSAVGLPLGIASAVCLLAAGSQGIRKRMRNSTWVGGLEAWTQFHMVLGAVG… |
| A0A534I3D5 | 171-443 | GRLFFVLVAAVLYLGWNTQTARYISPNRGVGYWLGIIGGSLMLLLLVYSLRKRWTWLSFLGSTPSWFRFHMVLGIAGPVCILYHANF… |
| A0A2E6VTC8 | 388-665 | None |
| A0A849IIY0 | 6-233 | None |
| A0A4P5QPP8 | 10-304 | None |
| A0A849TVK6 | 34-320 | None |
| A0A7T7YES3 | 32-303 | None |
| A0A7C5MZY1 | 246-522 | None |
| A0A4Y6S1U9 | 12-270 | None |
| A0A5C1AE09 | 4-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.