DPCstruct | MC8286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 564 ± 63 aa |
| Standard deviation of domain lengths | 63.16 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 16.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9WV09 | 60-619 | VNIMNSLNRRILKISDAFAHIAGGPRDITAVTTNHVHSTDLQVLVTAPSVPVSLPSTQPHGLISHFLFMFTRNDRRDEPPSETCYPT… |
| A0A0C3FAV0 | 1-578 | MLARQPQNELLDAIATILVRDVEVVAIAASGPNIVAIQDAIQQLPGSDADDNQNYSNVKIAGIGNPRKEDTYEFPDGRNFMMVKEGR… |
| A0A3N4LPV2 | 1-544 | None |
| A0A0C3B381 | 1-459 | None |
| A0A0C3ANU0 | 38-470 | None |
| A0A6A4GGP8 | 38-583 | None |
| N4V7U2 | 40-521 | None |
| A0A3N4LAN1 | 1-632 | None |
| A0A0C3F3B5 | 3-608 | None |
| A0A0C2W216 | 85-655 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.