DPCstruct | MC8285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 197 ± 36 aa |
| Standard deviation of domain lengths | 35.50 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 45.50 |
| Pfam Score | 87.18 |
| Assigned Pfam label(s) | PF08082- PF08083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2DZD3 | 227-432 | LPMMSTLYRLANQLLTDLVDFNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPY… |
| A0A0C3F3G8 | 2-197 | ANLYRFGHTLLSDQPDNNASYLFNKNTFFTAKALNMAIFGGPKFKPLYRDMDTFDEDWNEFNDIGKVIIRQQIRTEYKVAFPHLYNS… |
| A0A251RXT5 | 88-241 | None |
| A0A818FA94 | 23-189 | None |
| A0A818FAP1 | 1-192 | None |
| A0A0C2ZSK1 | 49-216 | None |
| A0A165N5V7 | 184-408 | None |
| A0A2S4VAW8 | 19-248 | None |
| M2QYQ5 | 143-339 | None |
| S9UW48 | 192-456 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.