DPCstruct | MC8283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 181 ± 26 aa |
| Standard deviation of domain lengths | 25.51 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3QL92 | 9-189 | VGPHFTEEAMYKVVDGIKAASGKLLQIVNFNIQQRLYVVAGENVNLETLSLASAAFKAVKSTAPEEVEKVIAESLAQTRARKEKCEQ… |
| A0A0C3EZR1 | 114-272 | YKGFEMAVLCRPSTRMLRSSFCTGVLPEIANYDVQGQQYVCADELVALQTLTNVLNYLKVHKVDICQVDGDFRRGEGMSEGYIKLER… |
| A0A7R7X2H5 | 884-1068 | None |
| A0A369JKT9 | 164-368 | None |
| H0EC84 | 675-846 | None |
| A0A2T6ZSF7 | 977-1189 | None |
| R1EQG3 | 495-682 | None |
| A0A5J4VRD4 | 21-254 | None |
| A0A6A4GE88 | 172-346 | None |
| X8F2C6 | 349-566 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.