DPCstruct | MC8282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 116 ± 9 aa |
| Standard deviation of domain lengths | 9.30 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533RSZ6 | 8-132 | DYKAFIQHSRAYYSKVIPETKKWSDEVTFGLYSPKGGTSGEMAMRWYRLGDKDCAKLEVFEDAFHALGQLKDLVDALAEVDSKLIQP… |
| A0A364GXG1 | 1-132 | MNPQKVSSRYFVHLKRAWYAEVTLRETPFVDEVCFGTVPASGAGTYGEMAVRWYRLDHVLAPRLEVFDDGWRLLADFGEILQAMAQV… |
| A0A6P1U714 | 49-143 | None |
| A0A1H1F603 | 1-116 | None |
| A0A1C5AAY5 | 7-121 | None |
| A0A351THU5 | 20-138 | None |
| A0A5S4F1W6 | 2-124 | None |
| A0A1V4VF88 | 1-110 | None |
| A0A345DE80 | 20-128 | None |
| A0A3D4WUH6 | 7-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.