DPCstruct | MC8280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 493 ± 52 aa |
| Standard deviation of domain lengths | 51.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 12.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5AZS7 | 43-516 | YILIRLPIGAGLYDLIASMQPQWDTVQGLLQELKDSESRYENDFFEEMVSLFEDILYKHSLDRSNPKGDELKAFILNEVKQGKNVCV… |
| A0A180FU36 | 16-449 | YGYFLRLALNTLQGDNFDYLLKRLDNNKELEKNEGGYSVGSLGDNNPKEALKKLIIFLKENKPKTEQLVKSLNKIERNCIVITDRED… |
| A0A1I2YT04 | 133-662 | None |
| A0A497PUA1 | 446-1003 | None |
| A0A0P6VYT5 | 208-672 | None |
| A0A7J2R8B0 | 31-519 | None |
| A0A1C4S613 | 9-455 | None |
| A0A411YEK9 | 57-594 | None |
| A0A0W8FFR3 | 196-758 | None |
| A0A5M3WS55 | 105-660 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.