DPCstruct | MC828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 123 ± 15 aa |
| Standard deviation of domain lengths | 15.23 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A272EUZ8 | 2-126 | IQISTALNDYRLNAVINFLAIGTENARVQIYGGERPDFGEEPDGDLLATIVLVEPIGEVEDGLLAITPTGEALIEASGVATWARIVN… |
| A0A4R8HTV0 | 1-129 | MRLAEAFASATLDDIKAALDGGKLVLYSTGRPIGPDHKITRSEVMATFTFQSPAFGPDAADGAAAPLFAEATVVASGIGTPGWARLS… |
| A0A812NS78 | 5-143 | None |
| A0A4Q7TWB6 | 1-130 | None |
| A0A656WU87 | 1-104 | None |
| A0A7V9A3R2 | 1-109 | None |
| A0A848A7H0 | 16-137 | None |
| E4PQ36 | 1-91 | None |
| B2IH57 | 1-126 | None |
| A0A0M0FPC1 | 3-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.